PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P36740_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 477aa    MW: 52854.7 Da    PI: 8.5027
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P36740_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS276.58.3e-851124761374
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalklf 84 
                            lv++L+++Ae +++g+   a+ +Larl+++   p g+p+ R ++yf+eAL+   a+s  +     pps+++ ++   ++ +l  +k+f
  GSMUA_Achr6P36740_001 112 LVDQLFKAAELIEAGNIVSARGILARLNHQlPFPVGKPLLRSVFYFKEALHLVAAKSHRS----PPPSSSAISTpldVVLKLGTYKTF 195
                            6899************************99899******************999993222....22222222223349999999**** PP

                   GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp....egppslRiTgvgspesgskeeleetgerLakf 168
                            s+vsPi++f+ +t+ qa+lea+ +++r+ iiDfdi+ G+QW a++q+La+R     +  p l+iT++ sp+s++  el+ ++++L +f
  GSMUA_Achr6P36740_001 196 SDVSPIVQFTSFTCIQALLEALGSATRIYIIDFDIGIGVQWSAFMQELAQRWstamAAVPYLKITAFTSPSSHHPLELHLIHQNLCHF 283
                            ***************************************************96666679***************************** PP

                   GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFler 256
                            A++l +pfef+vl  +++e  ++ ++    + a+aVnl +     +        +++++L++v +l Pk+vv v++ +d+ + +F+++
  GSMUA_Achr6P36740_001 284 ASSLSIPFEFDVLNLNDFEPSNFLRMCSALDAAVAVNLRVGSAACP--------PISTLLRFVTQLCPKIVVSVDHGCDRVDLPFAHH 363
                            ************955555555555554444**********999998........5678****************************** PP

                   GRAS 257 flealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                            +l+a++ +++l+ds++a  +++++  +k+Er l++++i+n+v  +  +      +   Wr    +aGF p+++s+++++qa++ll++v
  GSMUA_Achr6P36740_001 364 VLHAFQSCTVLLDSIDAA-GTNQDVVSKIERYLVQPRIENAVLGRRWS----SDKTLPWRTLYASAGFVPMRFSNFTETQAECLLKRV 446
                            ***************998.789999******************99998....777889****************************** PP

                   GRAS 345 ksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              +g++ve+++ sl l+W++r+LvsvSaW+
  GSMUA_Achr6P36740_001 447 LARGFHVEKRQTSLSLCWQRRELVSVSAWK 476
                            *****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.74186456IPR005202Transcription factor GRAS
PfamPF035142.9E-82112476IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MNKLLAQQQQ TQPPNCPSFF LPLHTSAGNR EDHQPQHFSS PLQKRPAVVD SFHGSRTPGL  60
FLRGDQPQQL GFPQHLNASA FQLQPTPAKP KLADGNESDA AAATMHQQHQ ALVDQLFKAA  120
ELIEAGNIVS ARGILARLNH QLPFPVGKPL LRSVFYFKEA LHLVAAKSHR SPPPSSSAIS  180
TPLDVVLKLG TYKTFSDVSP IVQFTSFTCI QALLEALGSA TRIYIIDFDI GIGVQWSAFM  240
QELAQRWSTA MAAVPYLKIT AFTSPSSHHP LELHLIHQNL CHFASSLSIP FEFDVLNLND  300
FEPSNFLRMC SALDAAVAVN LRVGSAACPP ISTLLRFVTQ LCPKIVVSVD HGCDRVDLPF  360
AHHVLHAFQS CTVLLDSIDA AGTNQDVVSK IERYLVQPRI ENAVLGRRWS SDKTLPWRTL  420
YASAGFVPMR FSNFTETQAE CLLKRVLARG FHVEKRQTSL SLCWQRRELV SVSAWKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3014747637375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009407162.10.0PREDICTED: scarecrow-like protein 6
TrEMBLM0TDB40.0M0TDB4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P36740_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20203796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-101GRAS family protein